Lineage for d6ecaa2 (6eca A:185-278)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. Protein automated matches [254633] (19 species)
    not a true protein
  7. Species Lactobacillus rhamnosus [TaxId:47715] [364801] (1 PDB entry)
  8. Domain d6ecaa2: 6eca A:185-278 [364802]
    Other proteins in same PDB: d6ecaa1, d6ecaa3, d6ecab1, d6ecab3
    automated match to d5c71a2
    complexed with cl, gol

Details for d6ecaa2

PDB Entry: 6eca (more details), 2.8499999999999996 Å

PDB Description: lactobacillus rhamnosus beta-glucuronidase
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d6ecaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ecaa2 b.1.4.0 (A:185-278) automated matches {Lactobacillus rhamnosus [TaxId: 47715]}
ervldytttfalagndatvnytvetngdapvtvsladadgqvvataqgkqgalqvqnahl
wqvrnaylytltiqlgddtqtpldtytdrigirt

SCOPe Domain Coordinates for d6ecaa2 are not available.

Timeline for d6ecaa2:

Domains from same chain:
(mouse over for more information)
d6ecaa1, d6ecaa3
Domains from other chains:
(mouse over for more information)
d6ecab1, d6ecab2, d6ecab3