SCOPe 2.07: Domain d6ec6b3: 6ec6 B:279-600

Lineage for d6ec6b3 (6ec6 B:279-600)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (125 species)
   not a true protein

7. Species Ruminococcus gnavus [TaxId:33038] [361249] (8 PDB entries)

8. Domain d6ec6b3: 6ec6 B:279-600 [364798]
   Other proteins in same PDB: d6ec6a1, d6ec6a2, d6ec6b1, d6ec6b2
   automated match to d5c70a3
   complexed with cl, gol

Details for d6ec6b3

PDB Entry: 6ec6, 2.85 Å

PDB Description: ruminococcus gnavus beta-glucuronidase

PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d6ec6b3:

Sequence; same for both SEQRES and ATOM records:

>d6ec6b3 c.1.8.0 (B:279-600) automated matches {Ruminococcus gnavus [TaxId: 33038]}
vriegtqillndrpvylkgfgkhedfsilgrgfhwgivkrdfeclkwtnancfrtshypy
aeewyqfadeegfliidevpavgmmrstrnfvaagsgnytyffealtvpellkshiadte
emitrdknhpsviawslfnepetitdyayeyfkevfaaaetydfqsrpmtgafeknskpe
lckcyplcdficlnryygwyisggpeieeaeelfrdemdrwkakelnvpfvftefgtdtm
aglhklpsimwseeyqkeylemnfrvfdsyefvqgelawnfadfqttegimrvdgnhkgv
ftrdrqpkaaavvfkdrwekkn

Timeline for d6ec6b3:

• d6ec6b3 is new in SCOPe 2.07-stable
  
• d6ec6b3 appears in the current release, SCOPe 2.08