Lineage for d6cfga1 (6cfg A:11-324)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2371474Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2371475Protein automated matches [227017] (44 species)
    not a true protein
  7. 3064715Species Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [364777] (1 PDB entry)
  8. 3064716Domain d6cfga1: 6cfg A:11-324 [364778]
    Other proteins in same PDB: d6cfga2, d6cfgb1, d6cfgb2
    automated match to d3ztna_
    complexed with ez7, nag, peg

Details for d6cfga1

PDB Entry: 6cfg (more details), 2.32 Å

PDB Description: crystal structure of the a/vietnam/1203/2004 (h5n1) influenza virus hemagglutinin in complex with small molecule jnj4796
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6cfga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cfga1 b.19.1.0 (A:11-324) automated matches {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d6cfga1:

Click to download the PDB-style file with coordinates for d6cfga1.
(The format of our PDB-style files is described here.)

Timeline for d6cfga1:

  • d6cfga1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-14

View in 3D
Domains from same chain:
(mouse over for more information)
d6cfga2