SCOPe 2.08: Domain d6cfgb1: 6cfg B:1-174

Lineage for d6cfgb1 (6cfg B:1-174)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [350163] (3 PDB entries)

8. Domain d6cfgb1: 6cfg B:1-174 [364776]
   Other proteins in same PDB: d6cfga1, d6cfga2, d6cfgb2
   automated match to d3m5jb_
   complexed with ez7, nag, peg

Details for d6cfgb1

PDB Entry: 6cfg, 2.32 Å

PDB Description: crystal structure of the a/vietnam/1203/2004 (h5n1) influenza virus hemagglutinin in complex with small molecule jnj4796

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6cfgb1:

Sequence; same for both SEQRES and ATOM records:

>d6cfgb1 h.3.1.0 (B:1-174) automated matches {Influenza A virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis

Timeline for d6cfgb1:

• d6cfgb1 first appeared in SCOPe 2.07