Lineage for d6a6ib_ (6a6i B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931514Protein Ubiquitin [54238] (9 species)
  7. 2931628Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 2932051Domain d6a6ib_: 6a6i B: [364774]
    automated match to d1zgub1
    protein/DNA complex; complexed with cl, gol

Details for d6a6ib_

PDB Entry: 6a6i (more details), 2.6 Å

PDB Description: crystal structure of the winged-helix domain of cockayne syndrome group b protein in complex with ubiquitin
PDB Compounds: (B:) Polyubiquitin-B

SCOPe Domain Sequences for d6a6ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a6ib_ d.15.1.1 (B:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyn
iqkestlhlvlrlr

SCOPe Domain Coordinates for d6a6ib_:

Click to download the PDB-style file with coordinates for d6a6ib_.
(The format of our PDB-style files is described here.)

Timeline for d6a6ib_: