Lineage for d2hed__ (2hed -)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (15 species) 
Species Human (Homo sapiens) [TaxId:9606] [53969] (181 PDB entries) 
Domain d2hed__: 2hed - [36475]
Details for d2hed__
PDB Entry: 2hed (more details), 1.8 Å
PDB Description: contribution of water molecules in the interior of a protein to the conformational stability
SCOP Domain Sequences for d2hed__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hed__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqan
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv
SCOP Domain Coordinates for d2hed__:
Click to download the PDB-style file with coordinates for d2hed__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hed__:
- d2hed__ first appeared (with stable ids) in SCOP 1.55
- d2hed__ appears in SCOP 1.57
- d2hed__ appears in SCOP 1.61
- d2hed__ appears in the current release, SCOPe 2.08, called d2heda_
View in 3D