Lineage for d5z9ja_ (5z9j A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. Protein automated matches [190847] (97 species)
    not a true protein
  7. Species Streptomyces himastatinicus [TaxId:457427] [346182] (5 PDB entries)
  8. Domain d5z9ja_: 5z9j A: [364749]
    automated match to d4e2pa_
    complexed with hem, tam

Details for d5z9ja_

PDB Entry: 5z9j (more details), 2 Å

PDB Description: identification of the functions of unusual cytochrome p450-like monooxygenases involved in microbial secondary metablism
PDB Compounds: (A:) Putative P450-like enzyme

SCOPe Domain Sequences for d5z9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z9ja_ a.104.1.0 (A:) automated matches {Streptomyces himastatinicus [TaxId: 457427]}
aqwefhpghfwmrgkrpdkivdydeelqlwnvygypesaailsnpkvfssdtmrldpikl
deaivegdfahtdppkhrrlrglvdhaftpslvakmesrvhgiihelldgvegksqfdlv
aefaaplplimisdllgvpesdralfrqwmdkmldgsekfespetvleqeeelhkelell
wemrdywheraaesrkrpredlisqlvhaevdgqklndsqisnianrllvnghlttamli
antmlcldafsdqdarvradrslvpalleesmrymspicgvgratnsevevagtvipkdq
lllvwtgaanrderqfekpdvfdagrspnahlglgrgihfclgrqlarmeskaaveilld
rlptlradpanpptflqvvdasgvatlpvvt

SCOPe Domain Coordinates for d5z9ja_ are not available.

Timeline for d5z9ja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5z9jb_, d5z9jc_, d5z9jd_