Lineage for d5z88a2 (5z88 A:336-506)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (32 species)
    not a true protein
  7. 2592469Species Unidentified influenza virus [TaxId:11309] [315420] (2 PDB entries)
  8. 3064676Domain d5z88a2: 5z88 A:336-506 [364738]
    Other proteins in same PDB: d5z88a1
    automated match to d1ha0a2
    complexed with gal, sia; mutant

Details for d5z88a2

PDB Entry: 5z88 (more details), 3 Å

PDB Description: crystal structure of h5 hemagglutinin g228s mutant with 3sln from a/chicken/taiwan/0502/2012
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5z88a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z88a2 h.3.1.0 (A:336-506) automated matches {Unidentified influenza virus [TaxId: 11309]}
agfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvnsiiskmnsqfeav
gkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhdsnvknlydkvrrql
rdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreeidsgl

SCOPe Domain Coordinates for d5z88a2:

Click to download the PDB-style file with coordinates for d5z88a2.
(The format of our PDB-style files is described here.)

Timeline for d5z88a2:

  • d5z88a2 appears in periodic updates to SCOPe 2.07 starting on 2019-02-11

View in 3D
Domains from same chain:
(mouse over for more information)
d5z88a1