Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Unidentified influenza virus [TaxId:11309] [225763] (9 PDB entries) |
Domain d5z88a1: 5z88 A:3-323 [364737] Other proteins in same PDB: d5z88a2, d5z88a3 automated match to d4we4a_ mutant |
PDB Entry: 5z88 (more details), 3 Å
SCOPe Domain Sequences for d5z88a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z88a1 b.19.1.0 (A:3-323) automated matches {Unidentified influenza virus [TaxId: 11309]} gdricigyhannsttqvdtimeknvtvthaqdilekehngrlcslkgvkplilkncsvag wllgnpmcdeflnapewsyivekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifpr sswsnhdassgvssacpyngrssffrnvvwlikknnvyrtitrtynntniedlliiwgih hpnnaaeqiklyqnpstyvsvgtstlnqrsipeiatrpkvngqssrmeffwtilrpndsi tfestgnfiapeyaykivkkgdsaimkselsysncdtkcqtpvgainssmpfhnvhpfai gecpkyvklkklvlatglrni
Timeline for d5z88a1: