Lineage for d1gboa_ (1gbo A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 187287Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 187288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 187297Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 187345Protein Lysozyme [53961] (16 species)
  7. 187536Species Human (Homo sapiens) [TaxId:9606] [53969] (183 PDB entries)
  8. 187587Domain d1gboa_: 1gbo A: [36473]

Details for d1gboa_

PDB Entry: 1gbo (more details), 1.8 Å

PDB Description: crystal structure of mutant human lysozyme substituted at the surface positions
PDB Compounds: (A:)

SCOP Domain Sequences for d1gboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gboa_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawgawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1gboa_:

Click to download the PDB-style file with coordinates for d1gboa_.
(The format of our PDB-style files is described here.)

Timeline for d1gboa_: