Lineage for d5za3a_ (5za3 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2307689Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2307775Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2307776Protein automated matches [190858] (19 species)
    not a true protein
  7. 3064664Species Streptococcus mutans [TaxId:1309] [364726] (1 PDB entry)
  8. 3064666Domain d5za3a_: 5za3 A: [364728]
    automated match to d2zxja_

Details for d5za3a_

PDB Entry: 5za3 (more details), 1.5 Å

PDB Description: structure of a c-terminal s. mutans response regulator vicr domain
PDB Compounds: (A:) DNA-binding response regulator

SCOPe Domain Sequences for d5za3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5za3a_ a.4.6.0 (A:) automated matches {Streptococcus mutans [TaxId: 1309]}
peiiigdlqilpdafvakkrgtevelthrefellhhlathtgqvmtrehlletvwgydyf
gdvrtvdvtvrrlrekiedtpsrpeyiltrrgvgyymksyd

SCOPe Domain Coordinates for d5za3a_:

Click to download the PDB-style file with coordinates for d5za3a_.
(The format of our PDB-style files is described here.)

Timeline for d5za3a_:

  • d5za3a_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-11

View in 3D
Domains from other chains:
(mouse over for more information)
d5za3b_