SCOPe 2.08: Domain d5z8ua_: 5z8u A:

Lineage for d5z8ua_ (5z8u A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187027] (13 PDB entries)

8. Domain d5z8ua_: 5z8u A: [364725]
   automated match to d5up8a_
   complexed with mg; mutant

Details for d5z8ua_

PDB Entry: 5z8u, 1.9 Å

PDB Description: human mitochondrial ferritin mutant - c102a/c130a

PDB Compounds: (A:) Ferritin, mitochondrial

SCOPe Domain Sequences for d5z8ua_:

Sequence; same for both SEQRES and ATOM records:

>d5z8ua_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srvrqnfhpdseaainrqinlelyasyvylsmayyfsrddvalnnfsryflhqsreeteh
aeklmrlqnqrggrirlqdikkpeqddwesglhameaallleknvnqsllelhalasdkg
dphladfletyylneqvksikelgdhvhnlvkmgapdaglaeylfdthtlg

Timeline for d5z8ua_:

• d5z8ua_ first appeared in SCOPe 2.07