Lineage for d5ovha_ (5ovh A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332645Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 2332646Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 2332647Family a.117.1.1: Ras GEF [48367] (2 proteins)
  6. 2332648Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. 2332649Species Human (Homo sapiens) [TaxId:9606] [48369] (60 PDB entries)
    Uniprot Q07889 189-1046
  8. 3064638Domain d5ovha_: 5ovh A: [364700]
    automated match to d1nvus_
    complexed with aww, edo

Details for d5ovha_

PDB Entry: 5ovh (more details), 2.3 Å

PDB Description: ras guanine nucleotide exchange factor sos1 (rem-cdc25) in complex with small molecule inhibitor compound 21
PDB Compounds: (A:) Son of sevenless homolog 1

SCOPe Domain Sequences for d5ovha_:

Sequence, based on SEQRES records: (download)

>d5ovha_ a.117.1.1 (A:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
gamaeeqmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmya
dpnfvrtflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrk
eyiqpvqlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqr
kkiardngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyrav
qpselvgsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieil
qvfqelnnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylakl
rsinppcvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpy
clrvesdikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspg
vrpsnp

Sequence, based on observed residues (ATOM records): (download)

>d5ovha_ a.117.1.1 (A:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
gamaeeqmrlpsadvyrfaepdseeniifeagipiikagtviklierltyhmyadpnfvr
tflttyrsfckpqellsliierfeipeaelkrfrkeyiqpvqlrvlnvcrhwvehhfydf
erdayllqrmeefigtvrgkamkkwvesitkiiqrkkiarditfqsspptvewhisrpgh
ietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeinspnllkmirhttn
ltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsamnsspvyrldhtf
eqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnilkteegnpevlkr
hgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmgnsmekeftdylf
nksleieprnpkplprfpkkysyplkspgvrpsnp

SCOPe Domain Coordinates for d5ovha_:

Click to download the PDB-style file with coordinates for d5ovha_.
(The format of our PDB-style files is described here.)

Timeline for d5ovha_:

  • d5ovha_ is new in SCOPe 2.07-stable