Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Chlamydia trachomatis [TaxId:471473] [364684] (3 PDB entries) |
Domain d6ns0b1: 6ns0 B:4-163 [364685] Other proteins in same PDB: d6ns0a2, d6ns0b2 automated match to d3a74a1 protein/RNA complex; complexed with cl, edo, krs, lys, na, peg, pg4 |
PDB Entry: 6ns0 (more details), 2.2 Å
SCOPe Domain Sequences for d6ns0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ns0b1 b.40.4.0 (B:4-163) automated matches {Chlamydia trachomatis [TaxId: 471473]} eveylqhedylyrtsklkeirdlginpypyqytdclevqeirnqfvdnelgdseaafrke tpkvrfagrlvlfrsmgknafgqildndakiqvmfnrdfsavaglaadagispikfiekk ldlgdilglegylffthsgeltvlvetvtllckslislpd
Timeline for d6ns0b1: