SCOPe 2.07: Domain d6ns0b1: 6ns0 B:4-163

Lineage for d6ns0b1 (6ns0 B:4-163)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (50 species)
   not a true protein

7. Species Chlamydia trachomatis [TaxId:471473] [364684] (3 PDB entries)

8. Domain d6ns0b1: 6ns0 B:4-163 [364685]
   Other proteins in same PDB: d6ns0a2, d6ns0b2
   automated match to d3a74a1
   protein/RNA complex; complexed with cl, edo, krs, lys, na, peg, pg4

Details for d6ns0b1

PDB Entry: 6ns0, 2.2 Å

PDB Description: crystal structure of lysyl-trna synthetase from chlamydia trachomatis complexed with l-lysine and cladosporin

PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6ns0b1:

Sequence; same for both SEQRES and ATOM records:

>d6ns0b1 b.40.4.0 (B:4-163) automated matches {Chlamydia trachomatis [TaxId: 471473]}
eveylqhedylyrtsklkeirdlginpypyqytdclevqeirnqfvdnelgdseaafrke
tpkvrfagrlvlfrsmgknafgqildndakiqvmfnrdfsavaglaadagispikfiekk
ldlgdilglegylffthsgeltvlvetvtllckslislpd

Timeline for d6ns0b1:

• d6ns0b1 is new in SCOPe 2.07-stable
  
• d6ns0b1 appears in the current release, SCOPe 2.08