Lineage for d6n4bs2 (6n4b S:124-235)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2371162Domain d6n4bs2: 6n4b S:124-235 [364681]
    Other proteins in same PDB: d6n4bb_, d6n4bc_, d6n4br_
    automated match to d5i4fa2
    complexed with clr, kca

Details for d6n4bs2

PDB Entry: 6n4b (more details), 3 Å

PDB Description: cannabinoid receptor 1-g protein complex
PDB Compounds: (S:) scFv16

SCOPe Domain Sequences for d6n4bs2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n4bs2 b.1.1.0 (S:124-235) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sdivmtqatssvpvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnl
asgvpdrfsgsgsgtaftltisrleaedvgvyycmqhleypltfgagtklel

SCOPe Domain Coordinates for d6n4bs2:

Click to download the PDB-style file with coordinates for d6n4bs2.
(The format of our PDB-style files is described here.)

Timeline for d6n4bs2: