Class a: All alpha proteins [46456] (290 folds) |
Fold a.127: L-aspartase-like [48556] (1 superfamily) multihelical, consists of three all-alpha domains |
Superfamily a.127.1: L-aspartase-like [48557] (3 families) |
Family a.127.1.0: automated matches [191431] (1 protein) not a true family |
Protein automated matches [190621] (30 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [225923] (9 PDB entries) |
Domain d6ig5c_: 6ig5 C: [364651] automated match to d1tj7a_ |
PDB Entry: 6ig5 (more details), 2.08 Å
SCOPe Domain Sequences for d6ig5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ig5c_ a.127.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} gpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdva dgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvat gvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkra avspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdls rlaediivwsstefgyvtlhdswstgssimpqkknpdiaelargksgrlignlagllatl kaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdl aewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqvrevltiegs vsardcrggtapgrvaeqlnaigeaaerlrrqlvr
Timeline for d6ig5c_: