SCOPe 2.07: Domain d6h9ua2: 6h9u A:215-406

Lineage for d6h9ua2 (6h9u A:215-406)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Cricetulus griseus [TaxId:10029] [364473] (2 PDB entries)

8. Domain d6h9ua2: 6h9u A:215-406 [364627]
   automated match to d1atra2
   complexed with mlt, na

Details for d6h9ua2

PDB Entry: 6h9u, 1.57 Å

PDB Description: crystal structure of the bip nbd and manf sap complex

PDB Compounds: (A:) Endoplasmic reticulum chaperone BiP

SCOPe Domain Sequences for d6h9ua2:

Sequence; same for both SEQRES and ATOM records:

>d6h9ua2 c.55.1.0 (A:215-406) automated matches {Cricetulus griseus [TaxId: 10029]}
egeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfiklykkkt
gkdvrkdnravqklrrevekakralssqhqarieiesffegedfsetltrakfeelnmdl
frstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrginpdeav
aygaavqagvls

Timeline for d6h9ua2:

• d6h9ua2 is new in SCOPe 2.07-stable
  
• d6h9ua2 appears in the current release, SCOPe 2.08