Lineage for d6h9ua2 (6h9u A:215-406)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2884952Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [364473] (3 PDB entries)
  8. 2884954Domain d6h9ua2: 6h9u A:215-406 [364627]
    automated match to d1atra2
    complexed with mlt, na

Details for d6h9ua2

PDB Entry: 6h9u (more details), 1.57 Å

PDB Description: crystal structure of the bip nbd and manf sap complex
PDB Compounds: (A:) Endoplasmic reticulum chaperone BiP

SCOPe Domain Sequences for d6h9ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h9ua2 c.55.1.0 (A:215-406) automated matches {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
egeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfiklykkkt
gkdvrkdnravqklrrevekakralssqhqarieiesffegedfsetltrakfeelnmdl
frstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrginpdeav
aygaavqagvls

SCOPe Domain Coordinates for d6h9ua2:

Click to download the PDB-style file with coordinates for d6h9ua2.
(The format of our PDB-style files is described here.)

Timeline for d6h9ua2: