SCOPe 2.07: Domain d6j5da_: 6j5d A:

Lineage for d6j5da_ (6j5d A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Louping ill virus [TaxId:11086] [364615] (1 PDB entry)

8. Domain d6j5da_: 6j5d A: [364616]
   Other proteins in same PDB: d6j5dh1, d6j5dh2, d6j5dl_
   automated match to d2jqma_

Details for d6j5da_

PDB Entry: 6j5d, 1.8 Å

PDB Description: complex structure of mab 4.2-scfv with louping ill virus envelope protein domain iii

PDB Compounds: (A:) Envelope

SCOPe Domain Sequences for d6j5da_:

Sequence; same for both SEQRES and ATOM records:

>d6j5da_ b.1.18.0 (A:) automated matches {Louping ill virus [TaxId: 11086]}
ytmcdkskfawkrtptdsghdtvvmevtfsgskpcripvravahgspdvnvamlitpnpt
iendgggfiemqlppgdniiyvgelshqwfqtgs

Timeline for d6j5da_:

• d6j5da_ is new in SCOPe 2.07-stable
  
• d6j5da_ appears in the current release, SCOPe 2.08