Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (72 species) not a true protein |
Species Louping ill virus [TaxId:11086] [364615] (1 PDB entry) |
Domain d6j5da_: 6j5d A: [364616] Other proteins in same PDB: d6j5dh1, d6j5dh2, d6j5dl_ automated match to d2jqma_ |
PDB Entry: 6j5d (more details), 1.8 Å
SCOPe Domain Sequences for d6j5da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j5da_ b.1.18.0 (A:) automated matches {Louping ill virus [TaxId: 11086]} ytmcdkskfawkrtptdsghdtvvmevtfsgskpcripvravahgspdvnvamlitpnpt iendgggfiemqlppgdniiyvgelshqwfqtgs
Timeline for d6j5da_: