SCOPe 2.07: Domain d6hare1: 6har E:8-56

Lineage for d6hare1 (6har E:8-56)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186911] (9 PDB entries)

8. Domain d6hare1: 6har E:8-56 [364613]
   Other proteins in same PDB: d6hara_, d6hare2
   automated match to d1ktha_
   complexed with ca, edo

Details for d6hare1

PDB Entry: 6har, 1.5 Å

PDB Description: crystal structure of mesotrypsin in complex with appi-m17c/i18f/f34c

PDB Compounds: (E:) Amyloid-beta A4 protein

SCOPe Domain Sequences for d6hare1:

Sequence; same for both SEQRES and ATOM records:

>d6hare1 g.8.1.1 (E:8-56) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaetgpcracfsrwyfdvtegkcapfcyggcggnrnnfdteeycmavcg

Timeline for d6hare1:

• d6hare1 is new in SCOPe 2.07-stable
  
• d6hare1 appears in the current release, SCOPe 2.08