Lineage for d6hare1 (6har E:8-56)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583928Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2583929Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2583930Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2584120Protein automated matches [190046] (3 species)
    not a true protein
  7. 2584151Species Human (Homo sapiens) [TaxId:9606] [186911] (9 PDB entries)
  8. 3064551Domain d6hare1: 6har E:8-56 [364613]
    Other proteins in same PDB: d6hara_, d6hare2
    automated match to d1ktha_
    complexed with ca, edo

Details for d6hare1

PDB Entry: 6har (more details), 1.5 Å

PDB Description: crystal structure of mesotrypsin in complex with appi-m17c/i18f/f34c
PDB Compounds: (E:) Amyloid-beta A4 protein

SCOPe Domain Sequences for d6hare1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hare1 g.8.1.1 (E:8-56) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaetgpcracfsrwyfdvtegkcapfcyggcggnrnnfdteeycmavcg

SCOPe Domain Coordinates for d6hare1:

Click to download the PDB-style file with coordinates for d6hare1.
(The format of our PDB-style files is described here.)

Timeline for d6hare1:

  • d6hare1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-10

View in 3D
Domains from same chain:
(mouse over for more information)
d6hare2
View in 3D
Domains from other chains:
(mouse over for more information)
d6hara_