![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
![]() | Protein automated matches [226850] (47 species) not a true protein |
![]() | Species Metallosphaera sedula [TaxId:43687] [364520] (2 PDB entries) |
![]() | Domain d6iheb2: 6ihe B:142-304 [364581] Other proteins in same PDB: d6ihea1, d6iheb1 automated match to d3czma2 complexed with edo, gol, mlt, nad, peg, pg4, pge |
PDB Entry: 6ihe (more details), 1.9 Å
SCOPe Domain Sequences for d6iheb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iheb2 d.162.1.0 (B:142-304) automated matches {Metallosphaera sedula [TaxId: 43687]} dqvetmrmrsfiakklkipvtsvdgfvggehgedavvlwstvkikgkpvdefninkdevs dyvkkipgeiirviggttwgpgtiiadiiksiafsenrvmsiatpkeyekeiihvsaptv vgssigpsleslldekdrwhlnsamkdfyeaykenlkqleqat
Timeline for d6iheb2: