SCOPe 2.08: Domain d6goma1: 6gom A:1-168

Lineage for d6goma1 (6gom A:1-168)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d6goma1: 6gom A:1-168 [364578]
   Other proteins in same PDB: d6goma2, d6gomb2, d6gomc2, d6gomd2, d6gome2, d6gomf2
   automated match to d4obea_
   complexed with cit, f6e, gnp, mg, po4

Details for d6goma1

PDB Entry: 6gom, 1.63 Å

PDB Description: kras-169 q61h gppnhp + ppin-1

PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d6goma1:

Sequence; same for both SEQRES and ATOM records:

>d6goma1 c.37.1.8 (A:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

Timeline for d6goma1:

• d6goma1 first appeared in SCOPe 2.07