Lineage for d6j63c2 (6j63 C:233-434)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942540Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2942578Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
  7. 2942610Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (16 PDB entries)
    Uniprot P93836 33-428 ! Uniprot P93836 63-459
  8. 2942642Domain d6j63c2: 6j63 C:233-434 [364572]
    automated match to d1sp9a2
    complexed with fe, ntd

Details for d6j63c2

PDB Entry: 6j63 (more details), 2.62 Å

PDB Description: crystal structure of arabidopsis thaliana hppd complexed with ntbc
PDB Compounds: (C:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d6j63c2:

Sequence, based on SEQRES records: (download)

>d6j63c2 d.32.1.3 (C:233-434) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
elgpaltyvagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrks
qiqtylehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgd
vlsddqikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayq
sggcggfgkgnfselfksieey

Sequence, based on observed residues (ATOM records): (download)

>d6j63c2 d.32.1.3 (C:233-434) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
elgpaltyvagftgfhqfaefglnsavlasndemvllpinepvhgrksqiqtylehnega
glqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikecee
lgilvdrddqgtllqiftkplgdrptifieiiqrvgcmqsggcggfgkgnfselfksiee
y

SCOPe Domain Coordinates for d6j63c2:

Click to download the PDB-style file with coordinates for d6j63c2.
(The format of our PDB-style files is described here.)

Timeline for d6j63c2: