Lineage for d1tdy__ (1tdy -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 251966Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 251967Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 251976Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 252026Protein Lysozyme [53961] (16 species)
    ubiquitous in a variety of tussues ans secretions
  7. 252220Species Human (Homo sapiens) [TaxId:9606] [53969] (200 PDB entries)
  8. 252297Domain d1tdy__: 1tdy - [36457]
    mutant

Details for d1tdy__

PDB Entry: 1tdy (more details), 1.7 Å

PDB Description: dissection of the functional role of structural elements of tyrosine- 63 in the catalytic action of human lysozyme

SCOP Domain Sequences for d1tdy__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdy__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srwwcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1tdy__:

Click to download the PDB-style file with coordinates for d1tdy__.
(The format of our PDB-style files is described here.)

Timeline for d1tdy__: