![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (319 species) not a true protein |
![]() | Species Metallosphaera sedula [TaxId:43687] [364518] (2 PDB entries) |
![]() | Domain d6ihea1: 6ihe A:2-141 [364569] Other proteins in same PDB: d6ihea2, d6iheb2 automated match to d3czma1 complexed with edo, gol, mlt, nad, peg, pg4, pge |
PDB Entry: 6ihe (more details), 1.9 Å
SCOPe Domain Sequences for d6ihea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ihea1 c.2.1.0 (A:2-141) automated matches {Metallosphaera sedula [TaxId: 43687]} akvgfigagkigqtiaysalvsgavdeaviydiipelpdkfehelrhafatkgikanvlg tnslddvsgmdivvisagkprkpgmsrrdlfvdnakimidlaqklpsknpgaiylmvanp vdmmasvfmkyskqftisag
Timeline for d6ihea1: