SCOPe 2.08: Domain d6ihea1: 6ihe A:2-141

Lineage for d6ihea1 (6ihe A:2-141)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Metallosphaera sedula [TaxId:43687] [364518] (2 PDB entries)

8. Domain d6ihea1: 6ihe A:2-141 [364569]
   Other proteins in same PDB: d6ihea2, d6iheb2
   automated match to d3czma1
   complexed with edo, gol, mlt, nad, peg, pg4, pge

Details for d6ihea1

PDB Entry: 6ihe, 1.9 Å

PDB Description: crystal structure of malate dehydrogenase from metallosphaera sedula

PDB Compounds: (A:) Malate dehydrogenase (NAD)

SCOPe Domain Sequences for d6ihea1:

Sequence; same for both SEQRES and ATOM records:

>d6ihea1 c.2.1.0 (A:2-141) automated matches {Metallosphaera sedula [TaxId: 43687]}
akvgfigagkigqtiaysalvsgavdeaviydiipelpdkfehelrhafatkgikanvlg
tnslddvsgmdivvisagkprkpgmsrrdlfvdnakimidlaqklpsknpgaiylmvanp
vdmmasvfmkyskqftisag

Timeline for d6ihea1:

• d6ihea1 first appeared in SCOPe 2.07