Lineage for d2mef__ (2mef -)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 405476Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 405477Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 405486Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 405538Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 405763Species Human (Homo sapiens) [TaxId:9606] [53969] (203 PDB entries)
  8. 405843Domain d2mef__: 2mef - [36456]
    complexed with na; mutant

Details for d2mef__

PDB Entry: 2mef (more details), 1.8 Å

PDB Description: contribution of hydrophobic effect to the conformational stability of human lysozyme

SCOP Domain Sequences for d2mef__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mef__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqmn
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d2mef__:

Click to download the PDB-style file with coordinates for d2mef__.
(The format of our PDB-style files is described here.)

Timeline for d2mef__: