Lineage for d2mee__ (2mee -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 28769Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 28802Protein Lysozyme [53961] (13 species)
  7. 28961Species Human (Homo sapiens) [TaxId:9606] [53969] (164 PDB entries)
  8. 29036Domain d2mee__: 2mee - [36455]

Details for d2mee__

PDB Entry: 2mee (more details), 1.8 Å

PDB Description: contribution of hydrophobic effect to the conformational stability of human lysozyme

SCOP Domain Sequences for d2mee__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mee__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqln
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d2mee__:

Click to download the PDB-style file with coordinates for d2mee__.
(The format of our PDB-style files is described here.)

Timeline for d2mee__: