SCOPe 2.08: Domain d6ieyb1: 6iey B:1-305

Lineage for d6ieyb1 (6iey B:1-305)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [196706] (50 PDB entries)

8. Domain d6ieyb1: 6iey B:1-305 [364549]
   Other proteins in same PDB: d6ieya2, d6ieyb2
   automated match to d1qz3a_
   complexed with clm

Details for d6ieyb1

PDB Entry: 6iey, 2.1 Å

PDB Description: crystal structure of chloramphenicol-metabolizaing enzyme estdl136- chloramphenicol complex

PDB Compounds: (B:) esterase

SCOPe Domain Sequences for d6ieyb1:

Sequence; same for both SEQRES and ATOM records:

>d6ieyb1 c.69.1.0 (B:1-305) automated matches {Uncultured bacterium [TaxId: 77133]}
mplnphveallqmmaqmpapdfsvanpaeiravfdnlaappqvarveniaisldgrdlda
rlyvpedaderpalmvyyhgggwvigtldthdgtcralaqksgcavlsiayrlapeyryp
apaedcydalvwakqnaatlgvdgdrlavggdaaggnlaaavaimardrngpalrhqlli
ypvtdndftlasyaengggeyylstdgmrwfwghylgdtaaenaplaavlnvadlsglap
atvitaeydplrdegiayakkldaagvpvdaatapgmihgffsmfeavpdswewiergas
nlkrdla

Timeline for d6ieyb1:

• d6ieyb1 first appeared in SCOPe 2.07