Lineage for d6ha7b2 (6ha7 B:215-407)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. Protein automated matches [226839] (64 species)
    not a true protein
  7. Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [364473] (3 PDB entries)
  8. Domain d6ha7b2: 6ha7 B:215-407 [364541]
    Other proteins in same PDB: d6ha7a3, d6ha7b3
    automated match to d1atra2
    complexed with edo

Details for d6ha7b2

PDB Entry: 6ha7 (more details), 2.4899999999999998 Å

PDB Description: crystal structure of the bip nbd and manf complex
PDB Compounds: (B:) Endoplasmic reticulum chaperone BiP

SCOPe Domain Sequences for d6ha7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ha7b2 c.55.1.0 (B:215-407) automated matches {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
egeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfiklykkkt
gkdvrkdnravqklrrevekakralssqhqarieiesffegedfsetltrakfeelnmdl
frstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrginpdeav
aygaavqagvlsg

SCOPe Domain Coordinates for d6ha7b2 are not available.

Timeline for d6ha7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ha7b1, d6ha7b3
View in 3D
Domains from other chains:
(mouse over for more information)
d6ha7a1, d6ha7a2, d6ha7a3