Lineage for d6ha7b1 (6ha7 B:28-214)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2492791Species Cricetulus griseus [TaxId:10029] [364473] (2 PDB entries)
  8. 2492796Domain d6ha7b1: 6ha7 B:28-214 [364540]
    Other proteins in same PDB: d6ha7a3, d6ha7b3
    automated match to d1atra1
    complexed with edo

Details for d6ha7b1

PDB Entry: 6ha7 (more details), 2.49 Å

PDB Description: crystal structure of the bip nbd and manf complex
PDB Compounds: (B:) Endoplasmic reticulum chaperone BiP

SCOPe Domain Sequences for d6ha7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ha7b1 c.55.1.0 (B:28-214) automated matches {Cricetulus griseus [TaxId: 10029]}
gtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqltsn
pentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeeisa
mvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaaai
aygldkr

SCOPe Domain Coordinates for d6ha7b1:

Click to download the PDB-style file with coordinates for d6ha7b1.
(The format of our PDB-style files is described here.)

Timeline for d6ha7b1: