![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein automated matches [190047] (37 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries) |
![]() | Domain d6gqwc1: 6gqw C:1-167 [364538] Other proteins in same PDB: d6gqwa2, d6gqwb2, d6gqwc2, d6gqwd2, d6gqwe2, d6gqwf2 automated match to d3gfta_ complexed with f8t, gnp, mg |
PDB Entry: 6gqw (more details), 2.8 Å
SCOPe Domain Sequences for d6gqwc1:
Sequence, based on SEQRES records: (download)
>d6gqwc1 c.37.1.8 (C:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
>d6gqwc1 c.37.1.8 (C:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag samrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrt vdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
Timeline for d6gqwc1: