SCOPe 2.08: Domain d6fk1a1: 6fk1 A:1-164

Lineage for d6fk1a1 (6fk1 A:1-164)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [364527] (1 PDB entry)

8. Domain d6fk1a1: 6fk1 A:1-164 [364528]
   Other proteins in same PDB: d6fk1a2
   automated match to d1m9ea_
   complexed with edo

Details for d6fk1a1

PDB Entry: 6fk1, 1.3 Å

PDB Description: cyclophilin a

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d6fk1a1:

Sequence; same for both SEQRES and ATOM records:

>d6fk1a1 b.62.1.1 (A:1-164) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mvnptvffditaddeplgrvsfelfadkvpktaenfralstgekgfgykgssfhriipgf
mcqggdftrhngtggrsiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitisdcgql

Timeline for d6fk1a1:

• d6fk1a1 first appeared in SCOPe 2.07