SCOPe 2.08: Domain d6ihdb2: 6ihd B:142-305

Lineage for d6ihdb2 (6ihd B:142-305)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Metallosphaera sedula [TaxId:43687] [364520] (2 PDB entries)

8. Domain d6ihdb2: 6ihd B:142-305 [364521]
   Other proteins in same PDB: d6ihda1, d6ihdb1
   automated match to d3czma2
   complexed with etx, nad

Details for d6ihdb2

PDB Entry: 6ihd, 2.3 Å

PDB Description: crystal structure of malate dehydrogenase from metallosphaera sedula

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d6ihdb2:

Sequence; same for both SEQRES and ATOM records:

>d6ihdb2 d.162.1.0 (B:142-305) automated matches {Metallosphaera sedula [TaxId: 43687]}
dqvetmrmrsfiakklkipvtsvdgfvggehgedavvlwstvkikgkpvdefninkdevs
dyvkkipgeiirviggttwgpgtiiadiiksiafsenrvmsiatpkeyekeiihvsaptv
vgssigpsleslldekdrwhlnsamkdfyeaykenlkqleqatk

Timeline for d6ihdb2:

• d6ihdb2 first appeared in SCOPe 2.07