Lineage for d6gqwb1 (6gqw B:1-167)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868621Domain d6gqwb1: 6gqw B:1-167 [364516]
    Other proteins in same PDB: d6gqwa2, d6gqwb2, d6gqwc2, d6gqwd2, d6gqwe2, d6gqwf2
    automated match to d3gfta_
    complexed with f8t, gnp, mg

Details for d6gqwb1

PDB Entry: 6gqw (more details), 2.8 Å

PDB Description: kras-169 q61h gppnhp + ch-1
PDB Compounds: (B:) GTPase KRas

SCOPe Domain Sequences for d6gqwb1:

Sequence, based on SEQRES records: (download)

>d6gqwb1 c.37.1.8 (B:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Sequence, based on observed residues (ATOM records): (download)

>d6gqwb1 c.37.1.8 (B:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
hesamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlps
rtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

SCOPe Domain Coordinates for d6gqwb1:

Click to download the PDB-style file with coordinates for d6gqwb1.
(The format of our PDB-style files is described here.)

Timeline for d6gqwb1: