Lineage for d6gomf1 (6gom F:1-167)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868254Domain d6gomf1: 6gom F:1-167 [364484]
    Other proteins in same PDB: d6goma2, d6gomb2, d6gomc2, d6gomd2, d6gome2, d6gomf2
    automated match to d4obea_
    complexed with cit, f6e, gnp, mg, po4

Details for d6gomf1

PDB Entry: 6gom (more details), 1.63 Å

PDB Description: kras-169 q61h gppnhp + ppin-1
PDB Compounds: (F:) GTPase KRas

SCOPe Domain Sequences for d6gomf1:

Sequence, based on SEQRES records: (download)

>d6gomf1 c.37.1.8 (F:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Sequence, based on observed residues (ATOM records): (download)

>d6gomf1 c.37.1.8 (F:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeyddsyrkqvvidgetclldildtagmrdq
ymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkqa
qdlarsygipfietsaktrqgvddafytlvreirkhk

SCOPe Domain Coordinates for d6gomf1:

Click to download the PDB-style file with coordinates for d6gomf1.
(The format of our PDB-style files is described here.)

Timeline for d6gomf1: