SCOPe 2.08: Domain d6fjqb_: 6fjq B:

Lineage for d6fjqb_ (6fjq B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein automated matches [190333] (6 species)
   not a true protein

7. Species Human adenovirus 48 [TaxId:39641] [364468] (1 PDB entry)

8. Domain d6fjqb_: 6fjq B: [364479]
   automated match to d1uxba_
   complexed with edo, gol, so4

Details for d6fjqb_

PDB Entry: 6fjq, 2.91 Å

PDB Description: adenovirus species 48, fiber knob protein

PDB Compounds: (B:) Fiber

SCOPe Domain Sequences for d6fjqb_:

Sequence; same for both SEQRES and ATOM records:

>d6fjqb_ b.21.1.1 (B:) automated matches {Human adenovirus 48 [TaxId: 39641]}
dkltlwttpdpspnckidqdkdskltfvltkcgsqilanmsllvvkgkfsminnkvngtd
dykkftikllfdekgvllkdssldkeywnyrsnnnnvgsayeeavgfmpsttaypkpptp
ptnpttpleksqaknkyvsnvylggqagnpvattvsfnketgctysitfdfawnktyenv
qfdssfltfsyiaqe

Timeline for d6fjqb_:

• d6fjqb_ first appeared in SCOPe 2.07