Lineage for d6fjqa_ (6fjq A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2371823Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2371824Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2371825Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2371917Protein automated matches [190333] (6 species)
    not a true protein
  7. 3064406Species Human adenovirus 48 [TaxId:39641] [364468] (1 PDB entry)
  8. 3064407Domain d6fjqa_: 6fjq A: [364469]
    automated match to d1uxba_
    complexed with edo, gol, so4

Details for d6fjqa_

PDB Entry: 6fjq (more details), 2.91 Å

PDB Description: adenovirus species 48, fiber knob protein
PDB Compounds: (A:) Fiber

SCOPe Domain Sequences for d6fjqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fjqa_ b.21.1.1 (A:) automated matches {Human adenovirus 48 [TaxId: 39641]}
dkltlwttpdpspnckidqdkdskltfvltkcgsqilanmsllvvkgkfsminnkvngtd
dykkftikllfdekgvllkdssldkeywnyrsnnnnvgsayeeavgfmpsttaypkpptp
ptnpttpleksqaknkyvsnvylggqagnpvattvsfnketgctysitfdfawnktyenv
qfdssfltfsyiaqe

SCOPe Domain Coordinates for d6fjqa_:

Click to download the PDB-style file with coordinates for d6fjqa_.
(The format of our PDB-style files is described here.)

Timeline for d6fjqa_:

  • d6fjqa_ is new in SCOPe 2.07-stable