Lineage for d2hef__ (2hef -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 28769Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 28802Protein Lysozyme [53961] (13 species)
  7. 28961Species Human (Homo sapiens) [TaxId:9606] [53969] (164 PDB entries)
  8. 28998Domain d2hef__: 2hef - [36446]

Details for d2hef__

PDB Entry: 2hef (more details), 1.8 Å

PDB Description: contribution of water molecules in the interior of a protein to the conformational stability

SCOP Domain Sequences for d2hef__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hef__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdnaadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d2hef__:

Click to download the PDB-style file with coordinates for d2hef__.
(The format of our PDB-style files is described here.)

Timeline for d2hef__: