Lineage for d6cbsb1 (6cbs B:445-580)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737962Fold a.236: DNA primase DnaG, C-terminal domain [117022] (1 superfamily)
    multihelical; segment-swapped dimer
  4. 2737963Superfamily a.236.1: DNA primase DnaG, C-terminal domain [117023] (2 families) (S)
    automatically mapped to Pfam PF08278
  5. 2737964Family a.236.1.1: DNA primase DnaG, C-terminal domain [117024] (2 proteins)
  6. 2737970Protein automated matches [364361] (1 species)
    not a true protein
  7. 2737971Species Escherichia coli [TaxId:83333] [364362] (3 PDB entries)
  8. 2737975Domain d6cbsb1: 6cbs B:445-580 [364452]
    automated match to d1t3wb_
    protein/DNA complex; complexed with acy, zn

Details for d6cbsb1

PDB Entry: 6cbs (more details), 1.85 Å

PDB Description: dnag primase c-terminal domain complex with ssb c-terminal peptide
PDB Compounds: (B:) DNA primase, single-stranded DNA-binding protein chimera

SCOPe Domain Sequences for d6cbsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cbsb1 a.236.1.1 (B:445-580) automated matches {Escherichia coli [TaxId: 83333]}
qlkrttmriligllvqnpelatlvpplenldenklpglglfrelvntclsqpglttgqll
ehyrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqeeliarerthgls
neerlelwtlnqelak

SCOPe Domain Coordinates for d6cbsb1:

Click to download the PDB-style file with coordinates for d6cbsb1.
(The format of our PDB-style files is described here.)

Timeline for d6cbsb1: