Lineage for d6flea_ (6fle A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56136] (58 PDB entries)
  8. Domain d6flea_: 6fle A: [364447]
    automated match to d3erka_
    complexed with dms, dq2, so4

Details for d6flea_

PDB Entry: 6fle (more details), 1.48 Å

PDB Description: crystal structure of erk2 in complex with an adenosine derivative
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d6flea_:

Sequence, based on SEQRES records: (download)

>d6flea_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtl
reikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyf
lyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyva
trwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsq
edlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqala
hpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfq

Sequence, based on observed residues (ATOM records): (download)

>d6flea_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtl
reikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyf
lyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyva
trwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsq
edlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqala
hpyleqyydpsdepiaeapflddlpkeklkelifeetarfq

SCOPe Domain Coordinates for d6flea_ are not available.

Timeline for d6flea_: