Lineage for d6flva_ (6flv A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544153Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2544205Species Norway rat (Rattus norvegicus) [TaxId:10116] [56136] (57 PDB entries)
  8. 3064384Domain d6flva_: 6flv A: [364446]
    automated match to d3erka_
    complexed with dms, dtw, so4

Details for d6flva_

PDB Entry: 6flv (more details), 1.91 Å

PDB Description: crystal structure of erk2 in complex with an adenosine derivative
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d6flva_:

Sequence, based on SEQRES records: (download)

>d6flva_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqp

Sequence, based on observed residues (ATOM records): (download)

>d6flva_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmlddlpkeklkelifeetarfqp

SCOPe Domain Coordinates for d6flva_:

Click to download the PDB-style file with coordinates for d6flva_.
(The format of our PDB-style files is described here.)

Timeline for d6flva_:

  • d6flva_ is new in SCOPe 2.07-stable