Lineage for d6dspb_ (6dsp B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. Protein automated matches [190646] (77 species)
    not a true protein
  7. Species Clostridium saccharobutylicum [TaxId:1345695] [364396] (1 PDB entry)
  8. Domain d6dspb_: 6dsp B: [364416]
    automated match to d4pz0a_
    complexed with pav

Details for d6dspb_

PDB Entry: 6dsp (more details), 1.37 Å

PDB Description: lsrb from clostridium saccharobutylicum in complex with ai-2
PDB Compounds: (B:) Autoinducer 2-binding protein lsrB

SCOPe Domain Sequences for d6dspb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dspb_ c.93.1.0 (B:) automated matches {Clostridium saccharobutylicum [TaxId: 1345695]}
vtvtfipkltgnaffesankgaqkyseqwgfkvdyegdanasaasqvsvinkavqqgtna
iclssvdaagvkdalkaaadagvtvttwdsdvdpsvrkvmvsqgtpeqlgqmlvqmgyds
lkergkdpekdaikycwhysnatvtdqnswqvegekyikskypnwqnvapdnyysnqdae
qaisvgesilsahsdidliicndstalpgqaqaaqnkgltaknvtitgfaspnsmkqycn
dgiltrwglwdcgiqgamgcymayyiasgnsvkvgdkieiptvgtvevmpnsvldpkadd
sdtssgvvllpertiftkdnmnnydf

SCOPe Domain Coordinates for d6dspb_ are not available.

Timeline for d6dspb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6dspa_