Lineage for d6cbvl1 (6cbv L:2-109)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1170 PDB entries)
  8. 3064347Domain d6cbvl1: 6cbv L:2-109 [364409]
    Other proteins in same PDB: d6cbvb_, d6cbvl2
    automated match to d3pgfl1
    complexed with fmt, gol, na

Details for d6cbvl1

PDB Entry: 6cbv (more details), 1.87 Å

PDB Description: crystal structure of bril bound to an affinity matured synthetic antibody.
PDB Compounds: (L:) Light Chain, Fab fragment

SCOPe Domain Sequences for d6cbvl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cbvl1 b.1.1.0 (L:2-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
rfsgsrsgtdftltisslqpedfatyycqqylyyslvtfgqgtkveik

SCOPe Domain Coordinates for d6cbvl1:

Click to download the PDB-style file with coordinates for d6cbvl1.
(The format of our PDB-style files is described here.)

Timeline for d6cbvl1:

  • d6cbvl1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-10

View in 3D
Domains from same chain:
(mouse over for more information)
d6cbvl2
View in 3D
Domains from other chains:
(mouse over for more information)
d6cbvb_