Lineage for d6enia_ (6eni A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.12: TrpR-like [48295] (4 families) (S)
    contains an extra shared helix after the HTH motif
  5. Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
    intertwined dimer of identical 6-helical subunits
    automatically mapped to Pfam PF01371
  6. Protein automated matches [254650] (4 species)
    not a true protein
  7. Species Escherichia coli [TaxId:83334] [340663] (7 PDB entries)
  8. Domain d6enia_: 6eni A: [364401]
    automated match to d5tm0a_
    complexed with edo, iac

Details for d6enia_

PDB Entry: 6eni (more details), 1.1 Å

PDB Description: tryptophan repressor trpr from e.coli variant t44l s88y with indole-3- acetic acid as ligand
PDB Compounds: (A:) trp operon repressor

SCOPe Domain Sequences for d6enia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6enia_ a.4.12.1 (A:) automated matches {Escherichia coli [TaxId: 83334]}
aqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmllpderealgtrvriveel
lrgemsqrelknelgagiatitrgsnylkaapvelrqwleevll

SCOPe Domain Coordinates for d6enia_ are not available.

Timeline for d6enia_:

Domains from other chains:
(mouse over for more information)
d6enib_