SCOPe 2.08: Domain d6epnr_: 6epn R:

Lineage for d6epnr_ (6epn R:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d6epnr_: 6epn R: [364395]
   Other proteins in same PDB: d6epns_
   automated match to d4lyhb_
   complexed with bq2, dms, gol

Details for d6epnr_

PDB Entry: 6epn, 2.5 Å

PDB Description: ras guanine exchange factor sos1 (rem-cdc25) in complex with kras(g12c) and fragment screening hit f2

PDB Compounds: (R:) GTPase KRas

SCOPe Domain Sequences for d6epnr_:

Sequence; same for both SEQRES and ATOM records:

>d6epnr_ c.37.1.8 (R:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvesrqaqdlarsygipfietsaktrqgvddafytlvreirkhkek

Timeline for d6epnr_:

• d6epnr_ first appeared in SCOPe 2.07