Lineage for d6bx8d_ (6bx8 D:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637558Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 2637559Protein automated matches [190829] (13 species)
    not a true protein
  7. 2637594Species Human (Homo sapiens) [TaxId:9606] [188132] (10 PDB entries)
  8. 2637599Domain d6bx8d_: 6bx8 D: [364380]
    Other proteins in same PDB: d6bx8a_, d6bx8c_, d6bx8e_, d6bx8g_
    automated match to d1dena_
    complexed with so4

Details for d6bx8d_

PDB Entry: 6bx8 (more details), 1.98 Å

PDB Description: human mesotrypsin (prss3) complexed with tissue factor pathway inhibitor variant (tfpi1-kd1-k15r-i17c-i34c)
PDB Compounds: (D:) tissue factor pathway inhibitor

SCOPe Domain Sequences for d6bx8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bx8d_ g.8.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sfcafkaddgpcracmkrfffniftrqceefcyggcegnqnrfesleeckkmc

SCOPe Domain Coordinates for d6bx8d_:

Click to download the PDB-style file with coordinates for d6bx8d_.
(The format of our PDB-style files is described here.)

Timeline for d6bx8d_: