Lineage for d6cjza1 (6cjz A:4-105)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376549Superfamily b.1.26: ICP-like [141066] (2 families) (S)
    topological variant with similarity to the Cupredoxin-like fold (49502) in the N-terminal region
  5. 2376566Family b.1.26.0: automated matches [191408] (1 protein)
    not a true family
  6. 2376567Protein automated matches [190560] (2 species)
    not a true protein
  7. 2376568Species Entamoeba histolytica [TaxId:5759] [364376] (1 PDB entry)
  8. 2376569Domain d6cjza1: 6cjz A:4-105 [364377]
    Other proteins in same PDB: d6cjza2
    automated match to d2c34a1

Details for d6cjza1

PDB Entry: 6cjz (more details)

PDB Description: solution structure of amebosin
PDB Compounds: (A:) Amoebiasin-1

SCOPe Domain Sequences for d6cjza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cjza1 b.1.26.0 (A:4-105) automated matches {Entamoeba histolytica [TaxId: 5759]}
msltednnnttitiakgenkeiilhgnpttgyswvvdsseglsntveyvadqhapgisgs
ggkyhikitgtqtgegkivlvyrrpwapnandrtftlkvnvq

SCOPe Domain Coordinates for d6cjza1:

Click to download the PDB-style file with coordinates for d6cjza1.
(The format of our PDB-style files is described here.)

Timeline for d6cjza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6cjza2