SCOPe 2.07: Domain d6akpc1: 6akp C:72-168

Lineage for d6akpc1 (6akp C:72-168)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)

6. Protein automated matches [190243] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187016] (11 PDB entries)

8. Domain d6akpc1: 6akp C:72-168 [364374]
   Other proteins in same PDB: d6akpc2
   automated match to d1vtnc_
   protein/DNA complex; complexed with mg

Details for d6akpc1

PDB Entry: 6akp, 2.32 Å

PDB Description: crystal structural of foxc2 dna binding domain bound to pc promoter

PDB Compounds: (C:) Forkhead box protein C2

SCOPe Domain Sequences for d6akpc1:

Sequence, based on SEQRES records:

>d6akpc1 a.4.5.14 (C:72-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kppysyialitmaiqnapekkitlngiyqfimdrfpfyrenkqgwqnsirhnlslnecfv
kvprddkkpgkgsywtldpdsynmfengsflrrrrrf

Sequence, based on observed residues (ATOM records):

>d6akpc1 a.4.5.14 (C:72-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kppysyialitmaiqnapekkitlngiyqfimdrfpfyrenkqgwqnsirhnlslnecfv
kvprdkgsywtldpdsynmfengsflrrrrrf

Timeline for d6akpc1:

• d6akpc1 is new in SCOPe 2.07-stable
  
• d6akpc1 appears in the current release, SCOPe 2.08