Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins) |
Protein automated matches [190243] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187016] (11 PDB entries) |
Domain d6akpc1: 6akp C:72-168 [364374] Other proteins in same PDB: d6akpc2 automated match to d1vtnc_ protein/DNA complex; complexed with mg |
PDB Entry: 6akp (more details), 2.32 Å
SCOPe Domain Sequences for d6akpc1:
Sequence, based on SEQRES records: (download)
>d6akpc1 a.4.5.14 (C:72-168) automated matches {Human (Homo sapiens) [TaxId: 9606]} kppysyialitmaiqnapekkitlngiyqfimdrfpfyrenkqgwqnsirhnlslnecfv kvprddkkpgkgsywtldpdsynmfengsflrrrrrf
>d6akpc1 a.4.5.14 (C:72-168) automated matches {Human (Homo sapiens) [TaxId: 9606]} kppysyialitmaiqnapekkitlngiyqfimdrfpfyrenkqgwqnsirhnlslnecfv kvprdkgsywtldpdsynmfengsflrrrrrf
Timeline for d6akpc1: