Lineage for d6akpc1 (6akp C:72-168)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)
  6. Protein automated matches [190243] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187016] (11 PDB entries)
  8. Domain d6akpc1: 6akp C:72-168 [364374]
    Other proteins in same PDB: d6akpc2
    automated match to d1vtnc_
    protein/DNA complex; complexed with mg

Details for d6akpc1

PDB Entry: 6akp (more details), 2.32 Å

PDB Description: crystal structural of foxc2 dna binding domain bound to pc promoter
PDB Compounds: (C:) Forkhead box protein C2

SCOPe Domain Sequences for d6akpc1:

Sequence, based on SEQRES records: (download)

>d6akpc1 a.4.5.14 (C:72-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kppysyialitmaiqnapekkitlngiyqfimdrfpfyrenkqgwqnsirhnlslnecfv
kvprddkkpgkgsywtldpdsynmfengsflrrrrrf

Sequence, based on observed residues (ATOM records): (download)

>d6akpc1 a.4.5.14 (C:72-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kppysyialitmaiqnapekkitlngiyqfimdrfpfyrenkqgwqnsirhnlslnecfv
kvprdkgsywtldpdsynmfengsflrrrrrf

SCOPe Domain Coordinates for d6akpc1 are not available.

Timeline for d6akpc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6akpc2